Add to Cart Compare Quick view TBARS assay Kit (MDA determination) Gentaur Genprice MSRP: Now: 365$ Was: Please note that BioQuochem items have a $300 minimum. Please contact us if you have any questions.The kit is designed to measure malondialdehyde (MDA) in biological samples.Background:... MSRP: Now: 365$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 365$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TBK1 (human; full length), pAb Gentaur Genprice MSRP: Now: 660$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 660$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 660$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TBK1 pSer172 (human; residues 168 – 177), pAb Gentaur Genprice MSRP: Now: 660$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 660$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 660$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TBK1 [GST-tagged] Gentaur Genprice MSRP: Now: 470$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 470$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 470$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TCA Deproteinizing Kit Gentaur Genprice MSRP: Now: 332$ Was: Please note that BioQuochem items have a $300 minimum. Please contact us if you have any questions.Proteins may interfere with some assays, affecting accuracy and sensitivity. When ultrafiltration... MSRP: Now: 332$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 332$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tear Mucin Assay Kit (O-Glycan Assay Method) Gentaur Genprice MSRP: Now: 1,175$ Was: MSRP: Now: 1,175$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 1,175$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Testosterone-11α (HRP-conjugated) Gentaur Genprice MSRP: Now: 428$ Was: ELISA competition method [Recommended to use together: Anti Testosterone 11(ALPHA) (Cat. No. FKA-104 or FKA-104-E) MSRP: Now: 428$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 428$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Testosterone-3 (HRP-conjugated) Gentaur Genprice MSRP: Now: 428$ Was: ELISA competition method.Recommended to use together: Anti Testosterone 3 (Cat. No. FKA-102 or FKA-102-E) MSRP: Now: 428$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 428$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Testosterone-BSA conjugate Gentaur Genprice MSRP: Now: 100$ Was: Type: Small Molecule AntigenFunction: OthersApplication: Immunogen, ELISAPurity: DialysisLead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage... MSRP: Now: 100$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 100$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Testosterone-OVA conjugate Gentaur Genprice MSRP: Now: 100$ Was: Type: Small Molecule AntigenFunction: OthersApplication: Immunogen, ELISAPurity: DialysisLead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage... MSRP: Now: 100$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 100$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tetracyclines ELISA Kit Gentaur Genprice MSRP: Now: 934$ Was: Detection Range: 0.05 ppb-4.05 ppb Sensitivity: 0.05 ppb Antigen Name: Tetracycline (TET) MSRP: Now: 934$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 934$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TG-Sure Expression (IR/MAR) Gentaur Genprice MSRP: Now: 1,876$ Was: Intended use: Novel mechanism of gene amplification discovered in cancer cell studies.Protein expression system in mammalian cells has the great advantage to produce mammalian protein... MSRP: Now: 1,876$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 1,876$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view THBR1-AS Gentaur Genprice MSRP: Now: 511$ Was: HAMA (Human anti-mouse antibody) interference is a common source of poor results in sandwich ELISA systems. This presents a significant problem, often causing false positive results in some assays... MSRP: Now: 511$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 511$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view THBR2 Gentaur Genprice MSRP: Now: 511$ Was: HAMA (Human anti-mouse antibody) interference is a common source of poor results in sandwich ELISA systems. This presents a significant problem, often causing false positive results in some assays... MSRP: Now: 511$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 511$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view The metabolite of furaltadone-BSA Gentaur Genprice MSRP: Now: 100$ Was: Type: Small Molecule AntigenFunction: othersApplication: Immunogen, ELISAPurity: DialysisLead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage... MSRP: Now: 100$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 100$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view The metabolite of furaltadone-OVA Gentaur Genprice MSRP: Now: 100$ Was: Type: Small Molecule AntigenFunction: othersApplication: Immunogen, ELISAPurity: DialysisLead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage... MSRP: Now: 100$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 100$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view The metabolite of furazolidone-BSA Gentaur Genprice MSRP: Now: 100$ Was: Type: Small Molecule AntigenFunction: othersApplication: Immunogen, ELISAPurity: DialysisLead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage... MSRP: Now: 100$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 100$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view The metabolite of furazolidone-OVA Gentaur Genprice MSRP: Now: 100$ Was: Type: Small Molecule AntigenFunction: othersApplication: Immunogen, ELISAPurity: DialysisLead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage... MSRP: Now: 100$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 100$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view THE-21-SUCC (HRP-conjugated) Gentaur Genprice MSRP: Now: 428$ Was: [Recommended to use together: Anti THF (Cat. No. FKA-434-E) MSRP: Now: 428$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 428$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermo T7 RNA Polymerase ((TT7)) Gentaur Genprice MSRP: Now: 313$ Was: To create RNA proble of high indication. To create precursor for RNA splicing reaction. To create mRNA with Cap analog as a primer. To create mRNA for in vitro Translation Thermo T7 RNA polymerase... MSRP: Now: 313$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 313$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermo T7 RNA Polymerase (TT7) Gentaur Genprice MSRP: Now: 953$ Was: To create RNA proble of high indication. To create precursor for RNA splicing reaction. To create mRNA with Cap analog as a primer. To create mRNA for in vitro Translation Thermo T7 RNA polymerase... MSRP: Now: 953$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 953$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermo T7 RNA Polymerase (TT7) (Highly concentrated) Gentaur Genprice MSRP: Now: 1,345$ Was: Thermo T7 RNA Polymerase (TT7) (Highly concentrated) is 50,000 units of an E. coli-produced, genetically modified T7 RNA polymerase offered at 50U/ul (with 10X reaction buffer). It features an ~85... MSRP: Now: 1,345$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 1,345$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermo T7 RNA Polymerase Buffer Gentaur Genprice MSRP: Now: 118$ Was: MSRP: Now: 118$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 118$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermostable Cell Transporter, K-type 20 Gentaur Genprice MSRP: Now: 586$ Was: MSRP: Now: 586$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 586$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermostable Cell Transporter, K-type 20, Plastic Box Gentaur Genprice MSRP: Now: 913$ Was: MSRP: Now: 913$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 913$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermostable Cell Transporter, K-type 5 Gentaur Genprice MSRP: Now: 586$ Was: MSRP: Now: 586$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 586$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thermostable Cell Transporter, K-type 5, Plastic Box Gentaur Genprice MSRP: Now: 913$ Was: MSRP: Now: 913$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 913$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Think, Test, Prove Hoody Gentaur Genprice MSRP: Now: 137$ Was: Think, Test, Prove Hoody Proud of the work scientists do? Our empiricism-inspired clothing... MSRP: Now: 137$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 137$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Think, Test, Prove T-shirt Gentaur Genprice MSRP: Now: 125$ Was: Think, Test, Prove T-shirt Proud of the work scientists do? Our empiricism-inspired clothing range is a great way to remind the world of the need for scientific method, while looking... MSRP: Now: 125$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 125$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Thiol Quantification Assay Kit (-SH/S-S) Gentaur Genprice MSRP: Now: 371$ Was: Please note that BioQuochem items have a $300 minimum. Please contact us if you have any questions.The kit is designed to measure free thiols and disulfides in biological samples. Background:... MSRP: Now: 371$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 371$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view THUNDERBIRD Probe qPCR Mix Gentaur Genprice MSRP: Now: 233$ Was: For real time PCR THUNDERBIRD® qPCR® Mix is a highly effective master mix (2 x concentration) for realtime PCR which has been developped with Taq DNA polymerase as a base.THUNDERBIRD®Probe... MSRP: Now: 233$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 233$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view THUNDERBIRD SYBR qPCR Mix Gentaur Genprice MSRP: Now: 233$ Was: For real time PCR THUNDERBIRD® SYBR® qPCR Mix is a highly efficient 2x Master Mix for real-time PCR using SYBR® Green I. The master mix contains all required components, except ROX... MSRP: Now: 233$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 233$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tissue Capture Gentaur Genprice MSRP: Now: 176$ Was: For improvement of section attachment to glass slides during immunohistochemical staining. The Tissue Capture Pen improves section attachment to glass slides during immunohistochemical staining. It... MSRP: Now: 176$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 176$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tissue Inhibitor of Metalloproteinase-1 (TIMP-1) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TIMP-1 ELISA Kit contains all components required for... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tissue Inhibitor of Metalloproteinase-1 (TIMP-1) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TIMP-1 ELISA Kit contains all components required for... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tissue Inhibitor of Metalloproteinases-3 (TIMP-3) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TIMP-3 ELISA Kit contains all components required for... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tissue Inhibitor of Metalloproteinases-3 (TIMP-3) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TIMP-3 ELISA Kit contains all components required for... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TNF-Related Apoptosis Inducing Ligand (TRAIL) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TRAIL ELISA Kit contains all components required for the... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TNF-Related Apoptosis Inducing Ligand (TRAIL) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TRAIL ELISA Kit contains all components required for the... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TNF-Related Apoptosis Inducing Ligand (TRAIL) Mouse, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse TRAIL ELISA Kit contains all components required for the... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TNF-Related Apoptosis Inducing Ligand (TRAIL) Mouse, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse TRAIL ELISA Kit contains all components required for the... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TNP-Ascaris Gentaur Genprice MSRP: Now: 661$ Was: MSRP: Now: 661$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 661$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TNP-BSA Gentaur Genprice MSRP: Now: 661$ Was: MSRP: Now: 661$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 661$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tol1-based Transgenesis Vector Gentaur Genprice MSRP: Now: 443$ Was: Donor and helper plasmids for transgenesis in vertebrates. Donor and helper plasmids for transgenesis in vertebrates. The donor plasmid contains terminal regions of the Tol1 element and multicloning... MSRP: Now: 443$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 443$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TOLLIP [GST-tagged] Gentaur Genprice MSRP: Now: 470$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 470$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 470$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TOM1 [GST-tagged] Gentaur Genprice MSRP: Now: 527$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 527$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 527$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Toscana Virus Glycoprotein 2 (Gc), Human Heterodimeric Fc-tag Gentaur Genprice MSRP: Now: 524$ Was: TOSCANA VIRUS GLYCOPROTEIN 2 (GC), HUMAN HETERODIMERIC FC-TAG Recombinant gene product from Toscana virus glycoprotein 2, corresponding to amino acid 838-1304 of the M segment polyprotein. A... MSRP: Now: 524$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 524$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Aflatoxins ELISA Kit Gentaur Genprice MSRP: Now: 1,084$ Was: Detection Range: 0.04 ppb-3.24 ppb Sensitivity: 0.04 ppb Antigen Name: Total Aflatoxin,AFT MSRP: Now: 1,084$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 1,084$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total GLP-1-HS ELISA Gentaur Genprice MSRP: Now: 967$ Was: Reactivity: Rat, Human For quantitative determination of total GLP-1 in rat and human plasma sample. The kit is characterized by sensitive quantification and high specificity. Supplementary:... MSRP: Now: 967$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 967$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-1 (MMP-1) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human Total MMP-1 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-1 (MMP-1) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human Total MMP-1 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-10 (MMP-10) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human Total MMP-10 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-10 (MMP-10) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human Total MMP-10 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-3 (MMP-3) Mouse, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse Total MMP-3 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-3 (MMP-3) Mouse, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse Total MMP-3 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-7 (MMP-7) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human Total MMP-7 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Total Matrix Metalloproteases-7 (MMP-7) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human Total MMP-7 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Touch Burner APT-3 Gentaur Genprice MSRP: Now: 316$ Was: Touch Burner APT-3 is portable, multipurpose butane burner. It features reliable ignition from a battery-powered igniter, an internal storage compartment that can be charged rapidly with widely... MSRP: Now: 316$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 316$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Toxocara Canis Antigen Gentaur Genprice MSRP: Now: 445$ Was: TOXOCARA CANIS ANTIGEN Toxocara canis antigen has been manufactured for use in the detection of antibodies against T. canis for immunoassay development or other applications. PRODUCT... MSRP: Now: 445$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 445$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TPX 1.5ml Micro Tube Gentaur Genprice MSRP: Now: 366$ Was: Accessory for CosmoSonic II Closed System Ultrasonic Disruptor Features: -TPX Tube is completely transparent to see sample aliquote and superior to chemical resistant.-Tubes can be used in autoclave... MSRP: Now: 366$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 366$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TRABID CD (245-697) [6His-tagged] Gentaur Genprice MSRP: Now: 470$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 470$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 470$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TRAF6 (mouse; full length), pAb Gentaur Genprice MSRP: Now: 660$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 660$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 660$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-alpha (TGF-alpha) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-alpha ELISA Kit contains all components required for... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-alpha (TGF-alpha) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-alpha ELISA Kit contains all components required for... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-beta 1 (TGF-beta 1) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-beta 1 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-beta 1 (TGF-beta 1) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-beta 1 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-beta 2 (TGF-beta 2) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-beta 2 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-beta 2 (TGF-beta 2) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-beta 2 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-beta 3 (TGF-beta 3) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-beta 3 ELISA Kit contains all components required... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transforming Growth Factor-beta 3 (TGF-beta 3) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TGF-beta 3 ELISA Kit contains all components required... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transthyretin (His-Tag) Gentaur Genprice MSRP: Now: 436$ Was: Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA... MSRP: Now: 436$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 436$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Transthyretin (Met) Gentaur Genprice MSRP: Now: 436$ Was: Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store... MSRP: Now: 436$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 436$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TRAP Staining Kit Gentaur Genprice MSRP: Now: 440$ Was: The TRAP Staining Kit (Cat.No.PMC-AK04F-COS) is used for the staining of Tartrate-Resistant Acid Phosphatase in osteoclasts. Bone mass is controlled by the balance between the activity of osteoblasts... MSRP: Now: 440$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 440$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TRIAD1 (human; full length), pAb Gentaur Genprice MSRP: Now: 660$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 660$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 660$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TRIAD1 [6His-tagged] Gentaur Genprice MSRP: Now: 384$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 384$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 384$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Triangular Cassette Long (10units) Gentaur Genprice MSRP: Now: 318$ Was: See all IVF and fertility-related products available from Cosmo Bio USA MSRP: Now: 318$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 318$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Triangular Cassette Short (10units) Gentaur Genprice MSRP: Now: 262$ Was: See all IVF and fertility-related products available from Cosmo Bio USA MSRP: Now: 262$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 262$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Trichomonas Vaginalis Antigen Gentaur Genprice MSRP: Now: 472$ Was: TRICHOMONAS VAGINALIS ANTIGEN Our Trichomonas antigen is supplied as washed and lysed purified Trichomonas vaginalis protozoa. Our Trichomonas antigens are suitable for IVD kit manufacture or... MSRP: Now: 472$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 472$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TRIM65 (human; full length), pAb Gentaur Genprice MSRP: Now: 660$ Was: Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may... MSRP: Now: 660$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 660$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tris Acid Sample Buffer Gentaur Genprice MSRP: Now: 134$ Was: Pre-treatment liquid sample preparation MSRP: Now: 134$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 134$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tris SDS (BETA) -ME Sample Buffer Gentaur Genprice MSRP: Now: 134$ Was: Pre-treatment liquid sample preparation MSRP: Now: 134$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 134$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tris SDS Sample Buffer Gentaur Genprice MSRP: Now: 134$ Was: Pre-treatment liquid sample preparation MSRP: Now: 134$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 134$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tris-acetic acid-EDTA (TAE) Running Buffer (50X) Gentaur Genprice MSRP: Now: 139$ Was: MSRP: Now: 139$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 139$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tris-boric acid-EDTA (TBE) Running Buffer (10X) Gentaur Genprice MSRP: Now: 134$ Was: MSRP: Now: 134$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 134$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tris-Glycine Running Buffer (10X) Gentaur Genprice MSRP: Now: 145$ Was: MSRP: Now: 145$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 145$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view TROLOX Standard Gentaur Genprice MSRP: Now: 150$ Was: Please note that BioQuochem items have a $300 minimum. Please contact us if you have any questions.Trolox is a water soluble analog of tocopherol (Vitamin E) which is a very strong antioxidant,... MSRP: Now: 150$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 150$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tube Checker (Black) Gentaur Genprice MSRP: Now: 142$ Was: Pen that can write on paper, plastic, glass and metal The 'Tube Checker'' pen enables you to write on paper, plastic, glass and metal. When dried, the writings are waterproof. Written parts also... MSRP: Now: 142$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 142$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tube Rack Gentaur Genprice MSRP: Now: 196$ Was: For protein and DNA extraction. The small but powerful handy homogenizer handheld unit and matching high performance pestles will make your repetitive labaoratory procedures easier, faster, and more... MSRP: Now: 196$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 196$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Bovine, ELISA Kit Gentaur Genprice MSRP: Now: 792$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Bovine Description: Bovine TNF-alpha ELISA Kit contains all components required... MSRP: Now: 792$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 792$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Canine, ELISA Kit Gentaur Genprice MSRP: Now: 792$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Feline Description: Cat TNF-alpha ELISA Kit contains all components required for... MSRP: Now: 792$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 792$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TNF-alpha ELISA Kit contains all components required for... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TNF-alpha ELISA Kit contains all components required for... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Mouse, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse TNF-alpha ELISA Kit contains all components required for... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Mouse, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse TNF-alpha ELISA Kit contains all components required for... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Rat, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Rat Description: Rat TNF-alpha ELISA Kit contains all components required for the... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-alpha (TNF-alpha) Rat, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Rat Description: Rat TNF-alpha ELISA Kit contains all components required for the... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-beta (TNF-beta) Human, ELISA Kit Gentaur Genprice MSRP: Now: 532$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TNF-beta ELISA Kit contains all components required for... MSRP: Now: 532$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 532$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tumor Necrosis Factor-beta (TNF-beta) Human, ELISA Kit, pink-ONE Gentaur Genprice MSRP: Now: 575$ Was: Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Human Description: Human TNF-beta ELISA Kit contains all components required for... MSRP: Now: 575$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 575$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Tylosin (TYL) ELISA kit Gentaur Genprice MSRP: Now: 1,024$ Was: Detection Range: Request Information Antigen Name: Tylosin MSRP: Now: 1,024$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 1,024$ Was: Subtotal: Add to Cart
Add to Cart Compare Quick view Type I collagenase assay kit Gentaur Genprice MSRP: Now: 826$ Was: For measurement collagenase activity [Back ground: Type I collagenase has an important role on the collagen metabolism and cleaves Type I collagen, which one of the collagen family comprising 9... MSRP: Now: 826$ Was: Add to Cart Compare Quick view Qty in Cart: 0 Quantity: Decrease Quantity: Increase Quantity: Price: MSRP: Now: 826$ Was: Subtotal: Add to Cart
