Transfection reagent for short oligonucleotides such as siRNA, antisense DNA or miRNA.As most transfection reagents have little gene expression activity in serum-containing medium, use of serum-free medium is recommended. LipoTrust™ has enough...

Transfection reagent for short oligonucleotides such as siRNA, antisense DNA or miRNA.As most transfection reagents have little gene expression activity in serum-containing medium, use of serum-free medium is recommended. LipoTrust™ has enough...

Transfection reagent for plasmid DNAAs most transfection reagents have little gene expression activity in serum-containing medium, use of serum-free medium is recommended. LipoTrust™ has enough gene expression activity in serum-containing medium...

For gene / nucleic acid transfectionThis is cationic liposome which consists of three highly effective transfection formulations strictly selected from more than three hundreds. What makes them unique is that no conversion to serum-free medium is...

Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.Forlong term storage, aliquot and...

Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and...

Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store at 4°C. After reconstituted, store no longer than 1-2...

Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA ALLSPYSYSTTAVVTNPKEWarning: Store at 4°C. After reconstituted, store no...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experience a weak signal or high background. IMMUNO SHOT improves these problems it as antibody diluents. Due to the principle ofworking mechanism,...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experience a weak signal or high background. IMMUNO SHOT improves these problems it as antibody diluents. Due to the principle ofworking mechanism,...

It is an antigen-antibody reaction promotion reagent improving lack of western blotting or the ELISA sensitivity and a high background. These products are made of 100% chemical ingredient and are designed to use various immunity assays system when you do...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experience a weak signal or high background. IMMUNO SHOT improves these problems it as antibody diluents. Due to the principle ofworking mechanism,...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experience a weak signal or high background. IMMUNO SHOT improves these problems it as antibody diluents. Due to the principle ofworking mechanism,...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experiences weak signal or high background. IMMUNO SHOT improves these problems by just using it as antibody diluents. Due to theprinciple of...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experiences weak signal or high background. IMMUNO SHOT improves these problems by just using it as antibody diluents. Due to theprinciple of...

IMMUNO SHOT is an enhancer of antigen-antibody reaction. In Western blotting and ELISA, researchers often experiences weak signal or high background. IMMUNO SHOT improves these problems by just using it as antibody diluents. Due to theprinciple of...

useful for research of chondroitin sulfateHeparan sulfate (HS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of D-iduronic acid (IdoUA) or D-glucuronic acid (GlcUA) and N-acetyl-D-glucosamine or N-sulfo-glucosamine. HS is...

useful for research of chondroitin sulfateHeparan sulfate (HS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of D-iduronic acid (IdoUA) or D-glucuronic acid (GlcUA) and N-acetyl-D-glucosamine or N-sulfo-glucosamine. HS is...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid,skin, umbilical cord, and...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid,skin, umbilical cord, and...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid, skin, umbilical cord, and...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid,skin, umbilical cord, and...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid, skin, umbilical cord, and...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid, skin, umbilical cord, and...

useful for research of chondroitin sulfateHyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid, skin, umbilical cord, and...

Useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcUA). HA is abundant in synovial fluid, skin, umbilical cord, and...

useful for research of chondroitin sulfateDermatan sulfate (DS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA) or D-iduronic acid (IdoUA). DS is abundant in...

useful for research of chondroitin sulfateChondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as...

Chondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as unbranched polysaccharide chains covalently...

useful for research of chondroitin sulfateChondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as...

useful for research of chondroitin sulfateChondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as...

Chondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as unbranched polysaccharide chains covalently...

useful for research of chondroitin sulfateChondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as...

useful for research of chondroitin sulfateChondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of N-acetyl-D-galactosamine (GalNAc) and D-glucuronic acid (GlcUA). CS is abundant in cartilage and exists as...

Other name: 2-acetamido-2-deoxy-3-O-(β-D-gluco-4-enepyranosyluronic acid)-D-galactoseContent: 500nmol/vial (lyophilized)Molecular Formula of Sodium Salt: C14H20NNaO11Formula Weight of Sodium Salt: 401.3Storage: below -20Υ in the dark.This product is...

Donor and helper plasmids for transgenesis in vertebrates.Donor and helper plasmids for transgenesis in vertebrates. The donor plasmid contains terminal regions of the Tol1 element and multicloning sites for integration of a gene to be transferred to...

Complete Culture Kit for Porcine Embryos _III_in vitro_IIII_This is a complete culture kit for porcine embryos in vitro containing porcine oocyte/embryo collection medium (POE-CM), basic medium for porcine oocyte maturation (POM), porcine fertilization...

Click here to see all products for porcine reproductive engineering. Basic Culture Kit for Porcine Embryos _III_in vitro_IIII_ This is a basic culture kit for porcine embryos in vitro containing porcine oocyte/embryo collection medium (POE-CM),...

For improvement of the rates of oocyte maturation, in vitro fertilization and embryo development.The originally designed culture plate (6-well with mortar shape) is easy handling of oocytes and embryos, and improves the rates of oocyte maturation, in...

For improvement of the normal oocyte maturation rate in basic medium for porcine oocyte maturation (POM)The addition of this component improves the normal oocyte maturation rate in basic medium for porcine oocyte maturation (POM) and/or high...

For washing and dilution of sperm used in insemination and preparation of isotonic percoll solution. Sterilized and ready to use.This can be used for the washing and dilution of sperm used in insemination and the preparation of isotonic percoll...

Defined medium for late stage porcine embryos (PBM)PBM is a medium that has added glucose and glycine in the defined medium for porcine embryos (PZM-5) ##1)###.PBM medium takes advantage for an improved embryo development after the morula stage, the...

Medium to culture porcine embryosPZM-5 medium is an improved defined medium ##3)### developed from the previous PZM-4 medium (Yoshioka et al. 1, ##2)###) for porcine embryo culture. This is useful for the culture of in vitro-derived embryos and in...

A serum-free basic medium for porcine oocyte maturationPFM is a complete synthetic medium that based on PGMtac4 (Yoshioka et al. ##1)###) and is optimized to porcine in vitro fertilization. This medium is sterilized and effectively supports in vitro...

Please add 10 IU /mL equine chorionic gonadotropin (eCG) + 10 IU/ ml human chorionic gonadotropin (hCG) to HP-POM medium during porcine oocyte maturation culture. There is no need to add porcine follicular fluid.HP-POM is a high-performance medium that...

To mature porcine oocytesThis is a modification medium which added polyvinyl alcohol to the original medium for porcine oocyte maturation (POM) (Yoshioka et al. ##1)###) and is a complete synthetic basic medium for oocyte maturation. This medium...

This medium kept warm to about 38°C is aseptically dispensed to sterile bottle or syringe and is used for collection or washing of porcine oocytes and embryos by the method of dissecting or aspirating ovaries.POE-CM is a suitable medium for...

RITC80-7 medium is a basal medium that was developed as a medium suitable for the colony-like growth and subculture of human fibroblasts. This medium has added serum, cell growth factors and is excellent for proliferation of various fibroblasts.

MCDB153 medium is a basic medium was has 6 amino acids added; histidine, isoleucine, tryptophan, tyrosine, methionine, and phenyl alamin.

The MCDB153 Medium has ingredients suitable for colony-like growth and maintainace of human epidermal keratinocytes. Adjustments have been made to improve the medium; 5.0×10##-6###Ｍ FeSO$$4$$$, and 5.0×10##-7###Ｍ ZnSO$$4$$$. This medium is...

MCDB107 medium is basal medium prepared by a modified MCDB104 medium suitable for the colony-like growth of human diploid fibroblasts. This medium is a basic medium suitable for growth of mesenchymal cells vascular endothelial cells, and vascular smooth...

A synthetic medium suitable for good in vitro growth of human normal fibroblasts.COSMEDIUM H001 (H001) is a ready-to-use chemically defined medium for supporting a long-term growth of normal human fibroblasts without animal-derived components such as...

This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to extract dye bound to calcified nodules. The optical absorbance of the extracted dye solution is then measured,...

This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to extract dye bound to calcified nodules. The optical absorbance of the extracted dye solution is then measured,...

This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to extract dye bound to calcified nodules. The optical absorbance of the extracted dye solution is then measured,...

Fatty acid-free bovine serum albumin (BSA) (0.05 g/ml) was incubated with 50 mM of glucose in a 0.05 M sodium phosphate buffer (pH 7.4) at 37°C for 24 weeks, followed by dialysis against PBS. The CML content (0.4 mol CML/mol BSA) was...

Gelatin (2 mg/ml) was incubated with 30 mM of ribose in a 0.2 M phosphate buffer (pH 7.4) at  37°C for 1 week, followed by dialysis against PBS. Volume  500 ulConcentration: 1 mg/mlStorage: Store below -20°C (below -70°C for...

Glycolaldehyde (33 mM) was incubated with bovine serum albumin (BSA) (2 mg/ml) at 37°C for  7 days in PBS (pH 7.4), and dialyzed against PBS.Concentration: 1 mg/ml

Bovine serum albumin (BSA) (50 mg/ml) was incubated at 37°C for 24 h with pyruvate and 100  mM sodium cyanoborohydride in 0.2 M sodium phosphate buffer (pH 7.8), followed by dialysis  against PBS. The CEL content (2.6 mol...

Bovine serum albumin (BSA) (50 mg/ml) was incubated at 37°C for 24 h with glyoxylic acid and  100 mM sodium cyanoborohydride in 0.2 M sodium phosphate buffer (pH 7.8), followed by dialysis against PBS. The CML content (2.3 mol...

3D cell culture systems for a range of different cells types including tumor cells and chondrocytes.Transformed cells, such as tumor cells, have the characteristic feature of anchorage- independent growth, unlike normal cells. Some normal cells, such...

Component of Alginate 3D Cell Culture KitTransformed cells, such as tumor cells, have the characteristic feature of anchorage- independent growth, unlike normal cells. Some normal cells, such as chondrocytes, are also capable of anchorage-independent...

Component of Alginate 3D Cell Culture KitTransformed cells, such as tumor cells, have the characteristic feature of anchorage- independent growth, unlike normal cells. Some normal cells, such as chondrocytes, are also capable of anchorage-independent...

Component of Alginate 3D Cell Culture KitTransformed cells, such as tumor cells, have the characteristic feature of anchorage- independent growth, unlike normal cells. Some normal cells, such as chondrocytes, are also capable of anchorage-independent...

For transfection of adenovirusGoldMAN is a gold/iron-oxide composite nanoparticles as a new type of magnetic beads for in-vitro and in-vivo applications. Au particles with sizes of less than 10 nm are homogeneously immobilized on the surface of support...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

Applications: Adjuvant for research of pristane-induced arthritis and for antibody productionThe isoprenoid alkane Pristane (2,6,10,14-tetramethylpentadecane) has found several important Applications in medical research and biotechnology including the...

Pure grade: >99.5%

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan, which does not include sulfate ester function, and it is isolated from the vitreous body of cow's eye by Dr...

Species Reactivity: Human  Sample Type: serum, plasma, tissue homogenates  Detection Range: 125 ng/ml-4000 ng/ml  Assay Duration: 1-5h  Sample Volume: 50-100ul  Detection Wavelength: 450...

Applications: 5-ALA is applied in variety of scientific fields with wide range. Please refer published papers for details of specific applications. Application in production of Cytochrome P450 (4) Improvement of harvest yield or increase of plant...

A Simplified Crystallization Method in the Capillary with Gel-TubeCounter-diffusion is a crystallization method in a capillary in which a protein and a reservoir solution diffuse into each other from opposite directions.1), 2) Both the protein and the...

A Simplified Crystallization Method in the Capillary with Gel-TubeCounter-diffusion is a crystallization method in a capillary in which a protein and a reservoir solution diffuse into each other from opposite directions.1), 2) Both the protein and the...